PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi05g23530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family SBP
Protein Properties Length: 191aa    MW: 21536.9 Da    PI: 8.4291
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi05g23530.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.51.4e-4169145278
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      Cq+e C adl+ ak+yhrrhkvCe hskap v+v+g++qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk++a
  Vradi05g23530.1  69 CQAEMCGADLTVAKRYHRRHKVCELHSKAPFVMVAGMRQRFCQQCSRFHELAEFDEAKRSCRRRLARHNERRRKSNA 145
                      **************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.0E-3562130IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.0666143IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.31E-3767147IPR004333Transcription factor, SBP-box
PfamPF031101.4E-3269142IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MEIKSTDRRQ VSIEKVRRDN PIEVEDEEEE EDESVAGGEG CLAEDERKKG GAGGGRRGST  60
GGGVSPPSCQ AEMCGADLTV AKRYHRRHKV CELHSKAPFV MVAGMRQRFC QQCSRFHELA  120
EFDEAKRSCR RRLARHNERR RKSNAETCNE GCSSSKGQHP TESLCRNADD WGRIQMNMAR  180
NSGYRSFHFR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-3355142184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0989280.0BT098928.1 Soybean clone JCVI-FLGm-16D18 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014501689.11e-138PREDICTED: squamosa promoter-binding-like protein 3
SwissprotQ387413e-40SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A0S3SIC61e-110A0A0S3SIC6_PHAAN; Uncharacterized protein
STRINGGLYMA13G35000.12e-95(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.12e-28squamosa promoter binding protein-like 3